PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC02G04370.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 219aa    MW: 23709.6 Da    PI: 10.1744
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC02G04370.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like94.11.1e-292275255
          G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                     pr+rW +eLH+rFv+av++LGG ++AtPk+i++lm+ kg++++hvkSHLQ+YR 
  OPUNC02G04370.1 22 PRMRWPEELHRRFVHAVRRLGGCHEATPKRIMQLMGAKGVSISHVKSHLQMYRN 75
                     9****************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.9E-271876IPR009057Homeodomain-like
PROSITE profilePS512949.6331878IPR017930Myb domain
SuperFamilySSF466893.23E-142076IPR009057Homeodomain-like
TIGRFAMsTIGR015573.8E-222275IPR006447Myb domain, plants
PfamPF002497.6E-82374IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 219 aa     Download sequence    Send to blast
MGGGGGGGSS VVVRRYNRSE APRMRWPEEL HRRFVHAVRR LGGCHEATPK RIMQLMGAKG  60
VSISHVKSHL QMYRNSNSSS NVNRRHPVSP QIDWTTAQDQ QQRRQMSSFS FLATKTVSSA  120
GIGRHGHQGP HRRQAPHAGD DGCELTLSIG GGAAEESKDG GSSITFDDEL LIQPAPNIIN  180
GSTQHGHRHP FACSTQPPPP AAAAINLELT ISSPCCWLT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8314000.0CT831400.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCRA117D12, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015624627.11e-118PREDICTED: two-component response regulator ARR18
TrEMBLA0A0E0JW161e-162A0A0E0JW16_ORYPU; Uncharacterized protein
STRINGORGLA02G0047700.11e-119(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP1991088
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14600.11e-20G2-like family protein